1.67 Rating by CuteStat

papaboisconservation.org is 6 years 1 month old. It is a domain having org extension. It has a global traffic rank of #16029080 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, papaboisconservation.org is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 30
Daily Pageviews: 60

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 16,029,080
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.24.103.214

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 23
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.24.103.214)

cetek.web.id | 522: Connection timed out

- cetek.web.id
Not Applicable $ 8.95

Code PSN Gratuit 2015 - Code PSN Générateur 2015

- codepsngratuit2014.com

Enfin le Code Psn Gratuit 2015 de travail et cartes-cadeaux PSN sont divulgués par PSN générateur de code. Code PSN Générateur 2015 offre PSN codes de carte

23,009,731 $ 8.95

[WTS] - █ Jasa Backlink PBN & Blog Placement Premium Tier [by Karinov]

- cyberlearning.web.id

Backlink PBN rasa Jasa SEO Salah satu keunggulan kami, bukan hanya backlink di DA/PA yang tinggi, tapi PBN ala Karinov ini juga berfungsi sebagai...

Not Applicable $ 8.95

Zahiraa | Welcome

- emp3.casa

Welcome to WordPress. This is your first post. Edit or delete it, then start blogging!

Not Applicable $ 8.95

Just a moment...

- aedaiduong.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 25 Mar 2018 05:16:28 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/5.5.6
Server: cloudflare
CF-RAY: 400ee7d5e27b4722-EWR
Content-Encoding: gzip

Domain Information

Domain Registrar: DropCatch.com 1498 LLC
Registration Date: Mar 23, 2018, 12:00 AM 6 years 1 month 6 days ago
Domain Status:
serverTransferProhibited
addPeriod
Owner's E-Mail: brian@webmasterplus.com

Domain Nameserver Information

Host IP Address Country
art.ns.cloudflare.com 173.245.59.102 United States of America United States of America
diva.ns.cloudflare.com 173.245.58.97 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
papaboisconservation.org A 300 IP: 104.24.102.214
papaboisconservation.org A 300 IP: 104.24.103.214
papaboisconservation.org NS 86400 Target: diva.ns.cloudflare.com
papaboisconservation.org NS 86400 Target: art.ns.cloudflare.com
papaboisconservation.org SOA 3600 MNAME: art.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2027354314
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
papaboisconservation.org AAAA 300 IPV6: 2400:cb00:2048:1::6818:66d6
papaboisconservation.org AAAA 300 IPV6: 2400:cb00:2048:1::6818:67d6

Similarly Ranked Websites

403 Forbidden

- onedefteam.xyz
16,029,090 $ 8.95

شمال موزیک

- shomalmusic.org

بزرگترین مرجع فول آلبوم موسیقی شمال ایران

16,029,121 $ 8.95

qlpxz.com - qlpxz Resources and Information.

- qlpxz.com

qlpxz.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, qlpxz.com has it all. We hope you find what you are searching for!

16,029,150 $ 8.95

Apple Support

- softwaresecurecloudestoragesystemsafewaningserveralert.xyz
16,029,182 $ 8.95

computerpointpotenza.com -&nbspInformationen zum Thema computerpointpo

- computerpointpotenza.com

computerpointpotenza.com ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf computerpointpotenza.com alles. Wir hoffen, dass Sie hier das Gesuchte finden!

16,029,235 $ 8.95

Full WHOIS Lookup

Domain Name: PAPABOISCONSERVATION.ORG
Registry Domain ID: D402200000005595212-LROR
Registrar WHOIS Server: whois.pir.org
Registrar URL: http://whois.pir.org/
Updated Date: 2018-03-24T00:54:19Z
Creation Date: 2018-03-23T14:39:25Z
Registry Expiry Date: 2019-03-23T14:39:25Z
Registrar Registration Expiration Date:
Registrar: Hichina Zhicheng Technology Limited
Registrar IANA ID: 420
Registrar Abuse Contact Email: DomainAbuse@service.aliyun.com
Registrar Abuse Contact Phone: +86.95187
Reseller:
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID: C204265441-LROR
Registrant Name: shao ning liu
Registrant Organization: liu shao ning
Registrant Street: yan tai shi fu shan qu xin hai jie 188hao
Registrant City: yan tai
Registrant State/Province: Shandong
Registrant Postal Code: 264000
Registrant Country: CN
Registrant Phone: +86.5353468384
Registrant Phone Ext:
Registrant Fax: +86.5353468384
Registrant Fax Ext:
Registrant Email: 1927571742@qq.com
Registry Admin ID: C204265440-LROR
Admin Name: shao ning liu
Admin Organization: liu shao ning
Admin Street: yan tai shi fu shan qu xin hai jie 188hao
Admin City: yan tai
Admin State/Province: Shandong
Admin Postal Code: 264000
Admin Country: CN
Admin Phone: +86.5353468384
Admin Phone Ext:
Admin Fax: +86.5353468384
Admin Fax Ext:
Admin Email: 1927571742@qq.com
Registry Tech ID: C204265440-LROR
Tech Name: shao ning liu
Tech Organization: liu shao ning
Tech Street: yan tai shi fu shan qu xin hai jie 188hao
Tech City: yan tai
Tech State/Province: Shandong
Tech Postal Code: 264000
Tech Country: CN
Tech Phone: +86.5353468384
Tech Phone Ext:
Tech Fax: +86.5353468384
Tech Fax Ext:
Tech Email: 1927571742@qq.com
Name Server: ART.NS.CLOUDFLARE.COM
Name Server: DIVA.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2018-03-25T05:15:39Z